Skip to main content
Free research Free research Free assay review with research home and workspace preview
Quick search ChEMBL 36
Assay Detail

CHEMBL5733933

Review assay metadata, readout intent, target linkage, and publication context from the same page.

Binding
BRM SM TR-FRET Binding Assay: Histidine epitope tagged BRM (Isoform 2) Bromodomain1377-1486 (S1377-Q1486; Swiss Prot P51531-2; mhhhhhhgslvpr\gsSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKEL PEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQ SVFKSARQ SEQ ID NO:2) was cloned, expressed, and purified to homogeneity. BRM-BD binding and inhibition was assessed by monitoring the engagement of a biotinylated small molecule ligand (Example 248) with the target using the TR-FRET assay technology (Perkin-Elmer). Specifically, in a 384 well ProxiPlate, His-BRM-BD (0.3 nM final) was combined with biotinylated-ligand (30 nM final) in 50 mM HEPES (pH 7.5), 50 mM NaCl, 1 mM TCEP, 0.01% (w/v) BSA, and 0.008% (w/v) Brij-35 either in the presence of DMSO (final 0.2% DMSO) or compound dilution series in DMSO. After 20 minutes incubation at room temperature, a mixture Eu-W1024 Anti-6×His antibody (“6×His” disclosed as SEQ ID NO: 4) (Perkin Elmer AD0110) and SureLight™ Streptavidin-Allophycocyanin (SA-APC, Perkin Elmer CR130-100) were added to a final concentrations of 0.2 nM antibody and 50 nM SA-APC, respectively. After sixty minutes equilibration, the plates were read on an Envision instrument and IC50s calculated using a four parameter non-linear curve fit.
93
Total Activities
31
Compounds Tested
3
Activity Types
0
Assay Parameters

Assay Information

Assay Type Binding
Confidence 0 — Uncurated / Unknown
Curated By Autocuration

Target

Unchecked (CHEMBL612545)
Type UNCHECKED

Publication

Therapeutic compounds and uses thereof
(2019)

Activity Statistics

Type Count Avg pChEMBL Best pChEMBL
IC50 31 7.32 8.24
kon 31 - -
k_off 31 - -

Compounds Tested

Compound Name Phase Activities Best pChEMBL
CHEMBL5990730 3 8.24
CHEMBL5828864 3 8.14
CHEMBL5986544 3 8.06
CHEMBL5420238 3 8.00
CHEMBL6015013 3 7.83
CHEMBL5799421 3 7.74
CHEMBL5936538 3 7.72
CHEMBL5764986 3 7.65
CHEMBL5784538 3 7.60
CHEMBL5834796 3 7.45
CHEMBL5880733 3 7.45
CHEMBL5927048 3 7.44
CHEMBL5177096 3 7.43
CHEMBL5914784 3 7.41
CHEMBL5837765 3 7.41
CHEMBL5424811 3 7.34
CHEMBL5952549 3 7.33
CHEMBL5930292 3 7.32
CHEMBL5781858 3 7.31
CHEMBL5771358 3 7.22
CHEMBL5870195 3 7.22
CHEMBL5887624 3 7.16
CHEMBL4782464 3 7.15
CHEMBL5938769 3 7.14
CHEMBL5781169 3 7.10
CHEMBL5869670 3 7.03
CHEMBL6048306 3 6.71
CHEMBL5876135 3 6.56
CHEMBL6046247 3 6.50
CHEMBL5854974 3 6.33

Activity Data

Compound Name Type Rel. Value Units pChEMBL
CHEMBL5990730 IC50 = 5.7 nM 8.24
CHEMBL5828864 IC50 = 7.2 nM 8.14
CHEMBL5986544 IC50 = 8.8 nM 8.06
CHEMBL5420238 IC50 = 10.0 nM 8.00
CHEMBL6015013 IC50 = 14.9 nM 7.83
CHEMBL5799421 IC50 = 18.4 nM 7.74
CHEMBL5936538 IC50 = 19.0 nM 7.72
CHEMBL5764986 IC50 = 22.5 nM 7.65
CHEMBL5784538 IC50 = 25.0 nM 7.60
CHEMBL5880733 IC50 = 35.8 nM 7.45
CHEMBL5834796 IC50 = 35.6 nM 7.45
CHEMBL5927048 IC50 = 36.1 nM 7.44
CHEMBL5177096 IC50 = 37.3 nM 7.43
CHEMBL5914784 IC50 = 39.3 nM 7.41
CHEMBL5837765 IC50 = 39.0 nM 7.41
CHEMBL5424811 IC50 = 45.9 nM 7.34
CHEMBL5952549 IC50 = 46.8 nM 7.33
CHEMBL5930292 IC50 = 47.6 nM 7.32
CHEMBL5781858 IC50 = 49.3 nM 7.31
CHEMBL5771358 IC50 = 60.7 nM 7.22
CHEMBL5870195 IC50 = 59.7 nM 7.22
CHEMBL5887624 IC50 = 69.6 nM 7.16
CHEMBL4782464 IC50 = 71.5 nM 7.15
CHEMBL5938769 IC50 = 71.7 nM 7.14
CHEMBL5781169 IC50 = 79.0 nM 7.10
CHEMBL5869670 IC50 = 92.5 nM 7.03
CHEMBL6048306 IC50 = 197.0 nM 6.71
CHEMBL5876135 IC50 = 276.0 nM 6.56
CHEMBL6046247 IC50 = 320.0 nM 6.50
CHEMBL5854974 IC50 = 466.0 nM 6.33
CHEMBL5930220 IC50 = 1040.0 nM 5.98
CHEMBL5930220 k_off = - s-1 -
CHEMBL6046247 kon = - -
CHEMBL5420238 kon = - -
CHEMBL5986544 kon = - -
CHEMBL5986544 k_off = - s-1 -
CHEMBL5784538 kon = - -
CHEMBL5784538 k_off = - s-1 -
CHEMBL5854974 kon = - -
CHEMBL5854974 k_off = - s-1 -
CHEMBL5914784 kon = - -
CHEMBL5914784 k_off = - s-1 -
CHEMBL6046247 k_off = - s-1 -
CHEMBL5828864 k_off = - s-1 -
CHEMBL5870195 kon = - -
CHEMBL5828864 kon = - -
CHEMBL5870195 k_off = - s-1 -
CHEMBL5177096 kon = - -
CHEMBL5177096 k_off = - s-1 -
CHEMBL5781858 k_off = - s-1 -