Skip to main content
Free research Free research Free assay review with research home and workspace preview
Quick search ChEMBL 36
Assay Detail

CHEMBL3388952

Review assay metadata, readout intent, target linkage, and publication context from the same page.

Binding
Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay in presence of 50% rat plasma
9
Total Activities
9
Compounds Tested
1
Activity Types
0
Assay Parameters

Assay Information

Assay Type Binding
Organism Homo sapiens
Tissue Plasma
Confidence 9 — Direct single protein target
Curated By Autocuration

Publication

Identification of potent and selective hydantoin inhibitors of aggrecanase-1 and aggrecanase-2 that are efficacious in both chemical and surgical models of osteoarthritis.
Durham TB, Klimkowski VJ, Rito CJ, Marimuthu J, Toth JL, Liu C, Durbin JD, Stout SL, Adams L, Swearingen C, Lin C, Chambers MG, Thirunavukkarasu K, Wiley MR.
J Med Chem (2014) 57 : 10476 -10485
PubMed 25415648 · DOI

Activity Statistics

Type Count Avg pChEMBL Best pChEMBL
IC50 9 6.55 7.75

Compounds Tested

Compound Name Phase Activities Best pChEMBL
CHEMBL187092 1 7.75
CHEMBL3358158 1 7.46
CHEMBL3358156 1 6.96
CHEMBL3358155 1 6.48
CHEMBL3358153 1 6.38
CHEMBL3358157 1 6.28
CHEMBL3358151 1 6.21
CHEMBL3358154 1 5.77
CHEMBL3358152 1 5.62

Activity Data

Compound Name Type Rel. Value Units pChEMBL
CHEMBL187092 IC50 = 18.0 nM 7.75
CHEMBL3358158 IC50 = 35.0 nM 7.46
CHEMBL3358156 IC50 = 110.0 nM 6.96
CHEMBL3358155 IC50 = 330.0 nM 6.48
CHEMBL3358153 IC50 = 420.0 nM 6.38
CHEMBL3358157 IC50 = 530.0 nM 6.28
CHEMBL3358151 IC50 = 620.0 nM 6.21
CHEMBL3358154 IC50 = 1700.0 nM 5.77
CHEMBL3358152 IC50 = 2400.0 nM 5.62