Skip to main content
Free research Free research Free assay review with research home and workspace preview
Quick search ChEMBL 36
Assay Detail

CHEMBL3776331

Review assay metadata, readout intent, target linkage, and publication context from the same page.

Binding
Inhibition of N-terminal His6-tagged full-length FIH (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using SMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN peptide/100 uM alpha-ketoglutarate as substrate/cofactor incubated for 45 mins by MALDI assay
6
Total Activities
6
Compounds Tested
1
Activity Types
0
Assay Parameters

Assay Information

Assay Type Binding
Organism Homo sapiens
Confidence 9 — Direct single protein target
Curated By Autocuration

Target

Hypoxia-inducible factor 1-alpha inhibitor (CHEMBL5909)
Type SINGLE PROTEIN
Organism Homo sapiens

Publication

Docking and Linking of Fragments To Discover Jumonji Histone Demethylase Inhibitors.
Korczynska M, Le DD, Younger N, Gregori-Puigjané E, Tumber A, Krojer T, Velupillai S, Gileadi C, Nowak RP, Iwasa E, Pollock SB, Ortiz Torres I, Oppermann U, Shoichet BK, Fujimori DG.
J Med Chem (2016) 59 : 1580 -1598
PubMed 26699912 · DOI

Activity Statistics

Type Count Avg pChEMBL Best pChEMBL
IC50 6 4.20 5.07

Compounds Tested

Compound Name Phase Activities Best pChEMBL
CHEMBL316034 1 5.07
CHEMBL3775867 1 3.33
CHEMBL3775262 1 -
CHEMBL3775272 1 -
CHEMBL3775380 1 -
CHEMBL3774598 1 -

Activity Data

Compound Name Type Rel. Value Units pChEMBL
CHEMBL316034 IC50 = 8600.0 nM 5.07
CHEMBL3775867 IC50 = 473000.0 nM 3.33
CHEMBL3775262 IC50 > 500000.0 nM -
CHEMBL3775272 IC50 > 500000.0 nM -
CHEMBL3775380 IC50 > 500000.0 nM -
CHEMBL3774598 IC50 > 500000.0 nM -