Skip to main content
Free research Free research Free assay review with research home and workspace preview
Quick search ChEMBL 36
Assay Detail

CHEMBL3862053

Review assay metadata, readout intent, target linkage, and publication context from the same page.

Binding
Inhibition of recombinant full-length human C-terminal His6-tagged CDK9/full-length human cyclin T1 expressed in baculovirus infected insect Sf21 cells using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate in presence of [gamma-33P]-ATP after 40 mins by scintillation counting analysis
5
Total Activities
5
Compounds Tested
1
Activity Types
0
Assay Parameters

Assay Information

Assay Type Binding
Organism Homo sapiens
Cell Type Sf21
Confidence 7 — Homologous single protein target
Curated By Autocuration

Target

CDK9/cyclin T1 (CHEMBL2111389)
Type PROTEIN COMPLEX
Organism Homo sapiens

Publication

Discovery of 4,6-disubstituted pyrimidines as potent inhibitors of the heat shock factor 1 (HSF1) stress pathway and CDK9.
Rye CS, Chessum NE, Lamont S, Pike KG, Faulder P, Demeritt J, Kemmitt P, Tucker J, Zani L, Cheeseman MD, Isaac R, Goodwin L, Boros J, Raynaud F, Hayes A, Henley AT, de Billy E, Lynch CJ, Sharp SY, Te Poele R, Fee LO, Foote KM, Green S, Workman P, Jones K.
Medchemcomm (2016) 7 : 1580 -1586
PubMed 27746890 · DOI

Activity Statistics

Type Count Avg pChEMBL Best pChEMBL
IC50 5 7.75 8.10

Compounds Tested

Compound Name Phase Activities Best pChEMBL
CHEMBL3972065 1 8.10
CHEMBL3928361 1 8.10
CHEMBL3919811 1 7.85
CHEMBL3919459 1 7.66
CHEMBL3922414 1 7.06

Activity Data

Compound Name Type Rel. Value Units pChEMBL
CHEMBL3972065 IC50 = 8.0 nM 8.10
CHEMBL3928361 IC50 = 8.0 nM 8.10
CHEMBL3919811 IC50 = 14.0 nM 7.85
CHEMBL3919459 IC50 = 22.0 nM 7.66
CHEMBL3922414 IC50 = 88.0 nM 7.06