Skip to main content
Free research Free research Free assay review with research home and workspace preview
Quick search ChEMBL 36
Assay Detail

CHEMBL4377494

Review assay metadata, readout intent, target linkage, and publication context from the same page.

Binding
Inhibition of recombinant full-length human CDK9/cyclinT1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC peptide as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method
15
Total Activities
15
Compounds Tested
1
Activity Types
0
Assay Parameters

Assay Information

Assay Type Binding
Organism Homo sapiens
Confidence 7 — Homologous single protein target
Curated By Autocuration

Target

CDK9/cyclin T1 (CHEMBL2111389)
Type PROTEIN COMPLEX
Organism Homo sapiens

Publication

Novel cyclin-dependent kinase 9 (CDK9) inhibitor with suppression of cancer stemness activity against non-small-cell lung cancer.
Wang X, Yu C, Wang C, Ma Y, Wang T, Li Y, Huang Z, Zhou M, Sun P, Zheng J, Yang S, Fan Y, Xiang R.
Eur J Med Chem (2019) 181 : 111535 -111535
PubMed 31376566 · DOI

Activity Statistics

Type Count Avg pChEMBL Best pChEMBL
IC50 15 7.67 8.22

Compounds Tested

Compound Name Phase Activities Best pChEMBL
CHEMBL4592737 1 8.22
CHEMBL4573953 1 8.05
CHEMBL4522831 1 8.05
CHEMBL4463566 1 8.00
CHEMBL4474633 1 7.96
CHEMBL4548580 1 7.96
CHEMBL4434746 1 7.92
CHEMBL4569530 1 7.82
CHEMBL4543127 1 7.60
CHEMBL4556152 1 7.48
CHEMBL4445923 1 7.47
CHEMBL4466046 1 7.38
CHEMBL4442345 1 7.30
CHEMBL4468293 1 7.17
CHEMBL3545110 RIBOCICLIB 4.0 1 6.71

Activity Data

Compound Name Type Rel. Value Units pChEMBL
CHEMBL4592737 IC50 = 6.0 nM 8.22
CHEMBL4573953 IC50 = 9.0 nM 8.05
CHEMBL4522831 IC50 = 9.0 nM 8.05
CHEMBL4463566 IC50 = 10.0 nM 8.00
CHEMBL4474633 IC50 = 11.0 nM 7.96
CHEMBL4548580 IC50 = 11.0 nM 7.96
CHEMBL4434746 IC50 = 12.0 nM 7.92
CHEMBL4569530 IC50 = 15.0 nM 7.82
CHEMBL4543127 IC50 = 25.0 nM 7.60
CHEMBL4556152 IC50 = 33.0 nM 7.48
CHEMBL4445923 IC50 = 34.0 nM 7.47
CHEMBL4466046 IC50 = 42.0 nM 7.38
CHEMBL4442345 IC50 = 50.0 nM 7.30
CHEMBL4468293 IC50 = 68.0 nM 7.17
CHEMBL3545110 RIBOCICLIB IC50 = 197.0 nM 6.71