Assay Detail
Binding
CHEMBL4013265
Review assay metadata, readout intent, target linkage, and publication context from the same page.
Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assay
8
Total Activities
8
Compounds Tested
1
Activity Types
0
Assay Parameters
Assay Information
| Assay Type | Binding |
| Organism | Homo sapiens |
| Confidence | 9 — Direct single protein target |
| Curated By | Autocuration |
Target
A disintegrin and metalloproteinase with thrombospondin motifs 5 (CHEMBL2285) ↗| Type | SINGLE PROTEIN |
| Organism | Homo sapiens |
Publication
A Highly Selective Hydantoin Inhibitor of Aggrecanase-1 and Aggrecanase-2 with a Low Projected Human Dose.
Activity Statistics
| Type | Count | Avg pChEMBL | Best pChEMBL |
|---|---|---|---|
| IC50 | 8 | 8.51 | 9.00 |
Compounds Tested
| Compound | Name | Phase | Activities | Best pChEMBL |
|---|---|---|---|---|
| CHEMBL4066965 | — | — | 1 | 9.00 |
| CHEMBL187092 | — | — | 1 | 9.00 |
| CHEMBL4072836 | — | — | 1 | 8.70 |
| CHEMBL3980860 | — | — | 1 | 8.70 |
| CHEMBL3972836 | — | — | 1 | 8.40 |
| CHEMBL4102193 | — | — | 1 | 8.30 |
| CHEMBL3955404 | — | — | 1 | 8.10 |
| CHEMBL4094455 | — | — | 1 | 7.89 |
Activity Data
| Compound | Name | Type | Rel. | Value | Units | pChEMBL |
|---|---|---|---|---|---|---|
| CHEMBL4066965 | — | IC50 | = | 1.0 | nM | 9.00 |
| CHEMBL187092 | — | IC50 | = | 1.0 | nM | 9.00 |
| CHEMBL4072836 | — | IC50 | = | 2.0 | nM | 8.70 |
| CHEMBL3980860 | — | IC50 | = | 2.0 | nM | 8.70 |
| CHEMBL3972836 | — | IC50 | = | 4.0 | nM | 8.40 |
| CHEMBL4102193 | — | IC50 | = | 5.0 | nM | 8.30 |
| CHEMBL3955404 | — | IC50 | = | 8.0 | nM | 8.10 |
| CHEMBL4094455 | — | IC50 | = | 13.0 | nM | 7.89 |