Compound Detail

CHEMBL4066965

Enter ChEMBL ID:

Free Research Context This compound will appear in recent viewed items on the research home for this browser.

C[C@H](Cc1ccc(C(F)(F)F)cc1)C(=O)NC[C@@]1(C2CC2)NC(=O)NC1=O

ChEMBL ↗ Properties Compare Identifier

Basic Information

ChEMBL ID	CHEMBL4066965
Phase	Preclinical
Structure Type	MOL
InChI Key	NPTUUUXCZCQNQS-QGHHPUGFSA-N

Targets

Activities

Assay Types

PK Parameters

Publications

Known Names

Molecular Properties

383.4

MW (Da)

1.99

ALogP

HBA

HBD

87.3

PSA (Å²)

0.66

QED

Ro5 Violations

Rot. Bonds

Drug Information

Molecule Type	Small molecule
Availability	Unknown
Chirality	Unknown

Flags

First in Class Prodrug

Extended Properties

Molecular Formula	C18H20F3N3O3
MW	383.37
Aromatic Rings	1
Heavy Atoms	27
NP-Likeness	-0.73

Activity Summary

IC50 20 meas. best 9.0

Target Activity Profile

Target	Type	Best pChEMBL	Mean pChEMBL	Best (nM)	# Data
A disintegrin and metalloproteinase with thrombospondin motifs 5 CHEMBL2285	IC50	9.0	8.6067	1.0	3
A disintegrin and metalloproteinase with thrombospondin motifs 4 CHEMBL2318	IC50	9.0	8.85	1.0	2
ADAM metallopeptidase with thrombospondin type 1 motif 4 CHEMBL3988592	IC50	9.0	7.87	1.0	2
Macrophage metalloelastase CHEMBL4393	IC50	8.05	8.05	9.0	2
A disintegrin-like and metallopeptidase (Reprolysin type) with thrombospondin type 1 motif, 5 (Aggrecanase-2) CHEMBL3988600	IC50	7.82	7.82	15.0	1
Neutrophil collagenase CHEMBL4588	IC50	7.75	7.75	17.9	1
Collagenase 3 CHEMBL280	IC50	5.96	5.96	1100.0	2
72 kDa type IV collagenase CHEMBL333	IC50	5.76	5.755	1750.0	2
Stromelysin-1 CHEMBL283	IC50	5.55	5.55	2800.0	2
Matrix metalloproteinase-14 CHEMBL3869	IC50	5.41	5.41	3890.0	2
Matrix metalloproteinase-9 CHEMBL321	IC50	4.92	4.92	12000.0	1

Activity Data Samples

Top measurements by pChEMBL value

Target	Type	Rel.	Value	Units	pChEMBL	Assay	PubMed
ADAM metallopeptidase with thrombospondin type 1 motif 4	IC50	=	1.0	nM	9.0	AlphaScreen Assay: The compounds of the present invention can be evaluated by us...	-
A disintegrin and metalloproteinase with thrombospondin motifs 4	IC50	=	1.0	nM	9.0	Inhibition of human ADAMTS4 using [protein fragment, 43 aa] pe...	28613895
A disintegrin and metalloproteinase with thrombospondin motifs 5	IC50	=	1.0	nM	9.0	Inhibition of human ADAMTS5 using [protein fragment, 43 aa] pe...	28613895
A disintegrin and metalloproteinase with thrombospondin motifs 5	IC50	=	1.0	nM	9.0	AlphaScreen Assay: The compounds of the present invention can be evaluated by us...	-
A disintegrin and metalloproteinase with thrombospondin motifs 4	IC50	=	2.0	nM	8.7	AlphaScreen Assay: The compounds of the present invention can be evaluated by us...	-
Macrophage metalloelastase	IC50	=	9.0	nM	8.05	In Vitro Fluorescence Assay: A continuous assay is used in which the substrate i...	-
Macrophage metalloelastase	IC50	=	9.0	nM	8.05	Inhibition of human MMP12 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminop...	28613895
A disintegrin-like and metallopeptidase (Reprolysin type) with thrombospondin type 1 motif, 5 (Aggrecanase-2)	IC50	=	15.0	nM	7.82	Shift AlphaScreen Assay : The AlphaScreen Assay is modified to include the testi...	-
A disintegrin and metalloproteinase with thrombospondin motifs 5	IC50	=	15.0	nM	7.82	Inhibition of human ADAMTS5 using [protein fragment, 43 aa] pe...	28613895
Neutrophil collagenase	IC50	=	17.9	nM	7.75	In Vitro Fluorescence Assay: A continuous assay is used in which the substrate i...	-
ADAM metallopeptidase with thrombospondin type 1 motif 4	IC50	=	183.0	nM	6.74	Shift AlphaScreen Assay : The AlphaScreen Assay is modified to include the testi...	-
Collagenase 3	IC50	=	1110.0	nM	5.96	In Vitro Fluorescence Assay: A continuous assay is used in which the substrate i...	-
Collagenase 3	IC50	=	1100.0	nM	5.96	Inhibition of human MMP13 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminop...	28613895
72 kDa type IV collagenase	IC50	=	1750.0	nM	5.76	In Vitro Fluorescence Assay: A continuous assay is used in which the substrate i...	-
72 kDa type IV collagenase	IC50	=	1800.0	nM	5.75	Inhibition of human MMP2 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopr...	28613895
Stromelysin-1	IC50	=	2845.0	nM	5.55	In Vitro Fluorescence Assay: A continuous assay is used in which the substrate i...	-
Stromelysin-1	IC50	=	2800.0	nM	5.55	Inhibition of human MMP3 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopr...	28613895
Matrix metalloproteinase-14	IC50	=	3890.0	nM	5.41	In Vitro Fluorescence Assay: A continuous assay is used in which the substrate i...	-
Matrix metalloproteinase-14	IC50	=	3900.0	nM	5.41	Inhibition of human MMP14 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminop...	28613895
Matrix metalloproteinase-9	IC50	=	12000.0	nM	4.92	In Vitro Fluorescence Assay: A continuous assay is used in which the substrate i...	-

Literature References

PubMed	DOI	Target Context	# Activities
28613895	10.1021/acs.jmedchem.7b00650	A disintegrin and metalloproteinase with thrombospondin motifs 5	2
28613895	10.1021/acs.jmedchem.7b00650	A disintegrin and metalloproteinase with thrombospondin motifs 4	1
28613895	10.1021/acs.jmedchem.7b00650	72 kDa type IV collagenase	1
28613895	10.1021/acs.jmedchem.7b00650	Stromelysin-1	1
28613895	10.1021/acs.jmedchem.7b00650	Macrophage metalloelastase	1
28613895	10.1021/acs.jmedchem.7b00650	Collagenase 3	1
28613895	10.1021/acs.jmedchem.7b00650	Matrix metalloproteinase-14	1
28613895	10.1021/acs.jmedchem.7b00650	Rattus norvegicus	1

Data from ChEMBL 36 via Core Engine